PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G135000.2.p
Common NameSb09g020110, SORBIDRAFT_09g020110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family SBP
Protein Properties Length: 786aa    MW: 85866.2 Da    PI: 5.446
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G135000.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP111.55.2e-35186260276
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                           Cqv+gCead+ e+k yhrrh+vC  +++a++v+++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k
  Sobic.009G135000.2.p 186 CQVPGCEADIRELKGYHRRHRVCLRCAHAAAVMLDGVQKRYCQQCGKFHILLDFDEDKRSCRRKLERHNKRRRRK 260
                           ************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-26181247IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.487183260IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-33184263IPR004333Transcription factor, SBP-box
PfamPF031106.3E-27186260IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 786 aa     Download sequence    Send to blast
MDVPDSGGGA PDAGEPIWDW GNLLDFVVQD DDSLVLPWDD AAAGIAAAAD PTEAATAPLL  60
PASPPLPQPV EVEPEPEPEP EPEPGPVLPP PPLRVQGIGR RVRKRDPRLV CPNYLAGRVP  120
CACPEVDEMV AAAEVEDVAT EFLAGARKKT KTAAAAARRS KAAAAGAAPG AAGGGAARAA  180
AAEMKCQVPG CEADIRELKG YHRRHRVCLR CAHAAAVMLD GVQKRYCQQC GKFHILLDFD  240
EDKRSCRRKL ERHNKRRRRK PDSKGTLDKE IDEQLDLSAD VSGDGELREE NMEGTTSEML  300
ETVLSNKVLD RETPVGSEDV LSSPTCTQPS LQNDQSKSVV TFAASVEACI GAKQESVKLV  360
NSPMHDTKSA YSSSCPTGRI SFKLYDWNPA EFPRRLRHQI FEWLASMPVE LEGYIRPGCT  420
ILTVFIAMPQ HMWDKLSDDA ADLLRNLVNS PNSLLLGKGA FFIHVNNMLF QVLKDGATLM  480
STRLDVQAPR IDYVHPTWFE AGKPGDLILY GSSLDQPNFR SLLSFDGDYL KHDCYRLTSH  540
DTFDRVENGD LIPDSQHEIF RINITQSRPD IHGPAFVEVE NIFGLSNFVP ILFGSKQLCS  600
ELERIQDALC GSYSKNNVLG SEILSNLERG RLEDHVTTFL GYVSHARNIV ERRANHDEKT  660
QIETGGIIVN SPNQPSLGAS LPHASENTDI GGDNKLNSAD EEETMPLVTR DVSHRHCCQP  720
DMTARWLKPS LIVTYPGGAT RMRLVTTVVV AAVLCFTACL VLFHPHGVGV LAAPVKRYLS  780
SDSAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A1e-37185267587squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1242260KRSCRRKLERHNKRRRRKP
2246258RRKLERHNKRRRR
3253260NKRRRRKP
4254259KRRRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.124070.0ovary
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439790.10.0hypothetical protein SORBIDRAFT_09g020110
SwissprotQ6I5760.0SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLC5YXS30.0C5YXS3_SORBI; Putative uncharacterized protein Sb09g020110
STRINGSb09g020110.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.21e-120squamosa promoter binding protein-like 7